SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318830|ref|YP_001511338.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158318830|ref|YP_001511338.1|
Domain Number - Region: 195-241
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0543
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.066
Further Details:      
 
Domain Number - Region: 104-152
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0837
Family SOUL heme-binding protein 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318830|ref|YP_001511338.1|
Sequence length 452
Comment hypothetical protein Franean1_7106 [Frankia sp. EAN1pec]
Sequence
MASLRHRTSYRPKVTATLLTVVVVAVAVSCSSDEKAAAAKSPPPTKADAGHSLKIDSKPL
SGPVCKTGEGGTLFVTTSCGDPLLNRPYVDKDERRTVTDKDTGVTVGYRYVHGGFRESKG
KFSFYFPSEYQGRFFQPTYPTVSVEDAAPHDIAFAISNNAYLVTTNNGGGLPQAGEIGGV
RVNAAAAKFSRTVAAQVYEDSARPRGYIYGASGGAYQTLGALENSEDVWDGGVPMVPGTP
NAIPSSQTVPLLGLRVLHDKLPQIVDAMEPGGSGKPYAGLTDEQQAVLREVTRMGFPPRG
WWDYKNMNTDTFEAVAGGVRILDPTYADDFWTKPGYAGTDPASSVGASRIQAEADVSDIT
GSPVTGLTLSSVPQGDLTGVDLVVLTGAAAGKTIPFVKVSGTEATFGNGADTAVTGALKP
GDRVRLVLQPQWSPCGLSSRIRRGVWRGAATA
Download sequence
Identical sequences A8L639
298653.Franean1_7106 gi|158318830|ref|YP_001511338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]