SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318842|ref|YP_001511350.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318842|ref|YP_001511350.1|
Domain Number 1 Region: 11-68
Classification Level Classification E-value
Superfamily Homeodomain-like 5.49e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0076
Further Details:      
 
Weak hits

Sequence:  gi|158318842|ref|YP_001511350.1|
Domain Number - Region: 88-198
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0222
Family Tetracyclin repressor-like, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158318842|ref|YP_001511350.1|
Sequence length 200
Comment TetR family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MPSSTDRAAPGLRERKKARTRAAIQTHALRLFREQGYNATTVEQIIDAAEVSETTFFRYF
PTKEEVVLQDDLDPLIIEAFHNQPADLTPIQAIRAAIRQQFDALTPDQRQAIQERTVLIV
AEPALRAAMLDQISQTMLLLADAIAERTGRPKDDLAVRTVAGSAIGAMLATLPALADDPN
ADLPALVDQALGHLEAGLPV
Download sequence
Identical sequences A8L651
298653.Franean1_7123 WP_020464507.1.9268 2005204883 gi|158318842|ref|YP_001511350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]