SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318917|ref|YP_001511425.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318917|ref|YP_001511425.1|
Domain Number 1 Region: 223-277
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000103
Family AraC type transcriptional activator 0.053
Further Details:      
 
Weak hits

Sequence:  gi|158318917|ref|YP_001511425.1|
Domain Number - Region: 178-216
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000354
Family AraC type transcriptional activator 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158318917|ref|YP_001511425.1|
Sequence length 297
Comment AraC family transcriptional regulator [Frankia sp. EAN1pec]
Sequence
MTTPAETFAVVDEYVRVAPVPALRPYIAWYSGYRQRGVAPALHRGLPSPYLTLIFALDEP
LIVVGHPDPHQAPGSYDTLLGGLHTSPALISHDGAQSGVQVALRPLGARALLGLPAGELA
DQDLPADAVLGDVCAEMRERMRAASGWVELFAVLDDILCRRAACRTSAVAPEIAEAWAML
ERARGSVSVVDLAAEVGWSARHLRSRFRTEIGLTPKAASRVIRFDHARRLLARRAVAGDT
GELTLADLAAGCGFFDQAHLAREFRALAGVPPSRWLAEEAGYPPTGRRARAENTGTK
Download sequence
Identical sequences A8L7F4
298653.Franean1_7200 gi|158318917|ref|YP_001511425.1| WP_020464579.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]