SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158318991|ref|YP_001511499.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158318991|ref|YP_001511499.1|
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 1.57e-36
Family NADH oxidase/flavin reductase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158318991|ref|YP_001511499.1|
Sequence length 206
Comment nitroreductase [Frankia sp. EAN1pec]
Sequence
MDALDCLMTRRTATRLVEPGPTDEQLAVMLAAATTAPDHKMLRPWRFVVVRGEAREVLAN
AITAAAEAVGGLAEPVIRKAAGKATRSPVLIAVIASRVPGARVPRAEQDASAAAAAQNLC
LAAHAQGVASAWKSTPLPDSDQVRAVFGLTGGEELLGWVELGTLSDAIPLPPREPVALSA
VASELTTGGQLAPVEWAAQPVPVDAY
Download sequence
Identical sequences A0A1S1Q128 A8L7M8
gi|158318991|ref|YP_001511499.1| 298653.Franean1_7274 WP_020464648.1.13248 WP_020464648.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]