SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158311936|ref|YP_001504444.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158311936|ref|YP_001504444.1|
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Homeodomain-like 1.56e-17
Family Homeodomain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158311936|ref|YP_001504444.1|
Sequence length 179
Comment IS630 family transposase [Frankia sp. EAN1pec]
Sequence
MRYATGGGLTPAGQVERERVRLAAADRFAAGATRTEVAREFKVTPKTAGCWYRAWESGGA
AALRSTGPVSSCRLDDRDLARLEAILRRGPGVYGWTDQRWTLARVAQVIRREFGITYTVP
GVWMLLDRNGWSCQLPVRRAVERDDTVVEEWKDRGWPAVKPPRRPGVPGSVSSTRQGRA
Download sequence
Identical sequences A8L685
298653.Franean1_0071 298653.Franean1_3007 298653.Franean1_3070 298653.Franean1_3168 298653.Franean1_4438 298653.Franean1_6341 298653.Franean1_7159 gi|158311936|ref|YP_001504444.1| gi|158314822|ref|YP_001507330.1| gi|158314880|ref|YP_001507388.1| gi|158314975|ref|YP_001507483.1| gi|158316215|ref|YP_001508723.1| gi|158318080|ref|YP_001510588.1| gi|158318876|ref|YP_001511384.1| WP_012157515.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]