SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314300|ref|YP_001506808.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314300|ref|YP_001506808.1|
Domain Number 1 Region: 45-144,242-336,650-843
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 7.19e-62
Family Calcium ATPase, transmembrane domain M 0.0057
Further Details:      
 
Domain Number 2 Region: 340-360,456-704
Classification Level Classification E-value
Superfamily HAD-like 3.34e-35
Family Meta-cation ATPase, catalytic domain P 0.0014
Further Details:      
 
Domain Number 3 Region: 147-238
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.18e-21
Family Calcium ATPase, transduction domain A 0.0022
Further Details:      
 
Domain Number 4 Region: 348-485
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000000116
Family Metal cation-transporting ATPase, ATP-binding domain N 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158314300|ref|YP_001506808.1|
Sequence length 857
Comment P-type HAD superfamily ATPase [Frankia sp. EAN1pec]
Sequence
MDRPAATTSASTEQDDPRDEPRTATDLATDPGAATDPGVGTDTGADLGTDARGLSAAEVA
ERVADGRVNDIPVRSSRSVGEIVRANVLTRINAIIGVLFVLIVIVGPVQDALFGGVIIAN
TLIGVIQEIRAKRTLDRLAVVGEARPVVRRDGVAAELAASEIVLDDVVELGSGDKIAVDG
LVFEAENLEVDESLLTGEADPVHKRPGDTVMSGSFVVAGSGAFRATRVGRAAYAAQLAEE
ASRFTLVHSQLRNGINTILRVVTWMIIPTGVALIISQILVNDDDLAEGIRRMVAGLVPMV
PEGLVLLTSVAFAVGVVRLGRRQCLVQELPAIEGLARVDVVCLDKTGTLTEAAMDVVELR
MLDDDTETGGGEETNGSKATAEAVLGTLGAADRRPNPSMQAIIDAWPAPAGWTIQADMPF
SSARKWSGAEITDPADPTGPAATWLLGAPDVLLPESHPALTEADRFGEQGLRVLLLATYG
ATLAEAVADPAEVPGLTTPVALVVIAQRLRADASDTLRYFAEQGVAAKVISGDNALSVGA
VAHTLGLPGAENPVDARTLPTDPEALADVLETHSVFGRVSPQQKREMVAALQSRGHAVAM
TGDGVNDVLALKDADIGVSMGSGSQATRAVAQIVLLNNSFATLPSVVGEGRRVIGNIERV
ANLFLTKTVYSVLLAIVVVITQVPYPFLPRHLTLIGSLTIGIPAFFLALAPNGERARPDF
VGRVLRFALPAGALAAAATLASYFLARSIYNGDLDAETSMATLTLFLVALWALAIVARPY
TWWRILLVATMALAFAVVLAVPYGQEFFQLSLVGTTGPWTGAAVALAGGITLEISWVFTR
RHLDAEATRSRPTPARS
Download sequence
Identical sequences A8L487
WP_020460065.1.9268 298653.Franean1_2470 gi|158314300|ref|YP_001506808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]