SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158314659|ref|YP_001507167.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158314659|ref|YP_001507167.1|
Domain Number 1 Region: 15-134
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 6.12e-31
Family 6-pyruvoyl tetrahydropterin synthase 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158314659|ref|YP_001507167.1|
Sequence length 140
Comment putative 6-pyruvoyl tetrahydropterin synthase [Frankia sp. EAN1pec]
Sequence
MERTVIESRISGAATFRIGKRFTFDAAHHLPSLPAGHKCSRVHGHTYTVEFVLAASELAG
PGFVTDFGDLAVAGRYLAESFDHRDLNEVLDVEPTSEALAQHLARWFLAEVEPGVHGRLV
AVRVSETPSSWAEYLIGESR
Download sequence
Identical sequences A8L9C2
gi|158314659|ref|YP_001507167.1| 298653.Franean1_2838 WP_020460417.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]