SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317682|ref|YP_001510190.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317682|ref|YP_001510190.1|
Domain Number 1 Region: 1600-2141
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.11e-158
Family Acetyl-CoA synthetase-like 0.000000103
Further Details:      
 
Domain Number 2 Region: 438-1004
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.59e-155
Family Acetyl-CoA synthetase-like 0.000000078
Further Details:      
 
Domain Number 3 Region: 5822-6414
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.7e-145
Family Acetyl-CoA synthetase-like 0.000000043
Further Details:      
 
Domain Number 4 Region: 4719-5311
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.42e-131
Family Acetyl-CoA synthetase-like 0.00000029
Further Details:      
 
Domain Number 5 Region: 3186-3702,4113-4190
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.4e-125
Family Acetyl-CoA synthetase-like 0.00000115
Further Details:      
 
Domain Number 6 Region: 5578-5825
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.67e-57
Family NRPS condensation domain (amide synthase) 0.045
Further Details:      
 
Domain Number 7 Region: 4482-4729
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.11e-56
Family NRPS condensation domain (amide synthase) 0.031
Further Details:      
 
Domain Number 8 Region: 2950-3192
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.22e-53
Family NRPS condensation domain (amide synthase) 0.024
Further Details:      
 
Domain Number 9 Region: 181-466
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.89e-48
Family NRPS condensation domain (amide synthase) 0.053
Further Details:      
 
Domain Number 10 Region: 1295-1322,1353-1562
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 9.34e-48
Family NRPS condensation domain (amide synthase) 0.036
Further Details:      
 
Domain Number 11 Region: 5392-5565
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2e-42
Family NRPS condensation domain (amide synthase) 0.018
Further Details:      
 
Domain Number 12 Region: 4260-4348,4378-4494
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2e-42
Family NRPS condensation domain (amide synthase) 0.018
Further Details:      
 
Domain Number 13 Region: 1-173
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.08e-38
Family NRPS condensation domain (amide synthase) 0.013
Further Details:      
 
Domain Number 14 Region: 1089-1309
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.67e-38
Family NRPS condensation domain (amide synthase) 0.027
Further Details:      
 
Domain Number 15 Region: 2772-2948
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.33e-36
Family NRPS condensation domain (amide synthase) 0.03
Further Details:      
 
Domain Number 16 Region: 6514-6731
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.11e-26
Family NRPS condensation domain (amide synthase) 0.033
Further Details:      
 
Domain Number 17 Region: 2235-2436
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.02e-25
Family NRPS condensation domain (amide synthase) 0.025
Further Details:      
 
Domain Number 18 Region: 3725-3871
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.18e-21
Family rRNA adenine dimethylase-like 0.081
Further Details:      
 
Domain Number 19 Region: 2457-2710
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.22e-20
Family NRPS condensation domain (amide synthase) 0.068
Further Details:      
 
Domain Number 20 Region: 4179-4278
Classification Level Classification E-value
Superfamily ACP-like 3.53e-19
Family Peptidyl carrier domain 0.0039
Further Details:      
 
Domain Number 21 Region: 5293-5371
Classification Level Classification E-value
Superfamily ACP-like 2.75e-18
Family Peptidyl carrier domain 0.0039
Further Details:      
 
Domain Number 22 Region: 2123-2190
Classification Level Classification E-value
Superfamily ACP-like 8.51e-17
Family Peptidyl carrier domain 0.014
Further Details:      
 
Domain Number 23 Region: 6718-6994
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.00000000000000233
Family Choline/Carnitine O-acyltransferase 0.085
Further Details:      
 
Domain Number 24 Region: 984-1053
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000000144
Family Peptidyl carrier domain 0.0071
Further Details:      
 
Domain Number 25 Region: 6395-6484
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000615
Family Peptidyl carrier domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158317682|ref|YP_001510190.1|
Sequence length 6999
Comment amino acid adenylation domain-containing protein [Frankia sp. EAN1pec]
Sequence
MWFLQQLDPSSAAYNVAASFDLTGPVDADALHAALRAVARGHEILRTTYRVPAGGRPEQV
VHAELDPQWSSHDVSGEPSASRERLADEIARHAARRPFDLTSSSPLRVTLIRLAADRFVL
VVVAHHVAWDDASWEIFFRELFAHYDNLRAGDGPLPADERTAQYIDVAGQPRGADAQDPD
PAALDYWRGQLTALPEPLRLPGGEPVAAATAAGADPGKPADPGKLADPGKLADPGGQVVH
QAAAGLGRRVRAFAAEHGATPFMVLLAAFAAVLHRHTGATDIVVGSPVVNRDQPGADRLI
GYFGNTVALRVRVRPGDSFRDLLARTSETCRGAFAHQHVDLEDVVRAVNPDRSDGVSSVF
TTLFAVRTAAAEHLGARELSGARRPLHTGDAQFPLGVTVEIGADQLDLEAGFLTAAVTAG
SAGAVLRHLETFLDHATRHPRRPLAAVDLLTDSERRRTLVDWNNTAAPSPDATWAELLAR
RAARAPGHAAVVTSGGTLTYGELVGRADALAYQLRGLGTGPGAIVALALPRTLDLVVALA
GVTRAGAAYLPVDPGYPADRITLVLEDAAPSLLITTRELAATLPIPAGVTVVLVNGPAAG
PEAGTEFGTEFGSVPEPPAAAAVPAELGSAAYVIYTSGSTGRPKGVVVPHRALTNFLASM
VDQFQLGDGDRVLALTTLSFDIAALELLAPLTAGATVHLAGQDEARDPTALAALLAGGGI
TVAQATPSMWQSILAASDDRFPGVRVLSGGEGLPPAVAATLAERADEVVNLYGPTETTIW
STAGPVAGDGRPTVGRPIRSTQVYLLDTALAPVAPGMPGELYIGGAGVADGYLRRPGLTA
SRFVADPFSAGGRLYRTGDLARWTADGELDVLGRVDDQVKVRGFRIEPGEVEAVLGRHPA
VARCAVVARDDGPAGRHLVAYVVPAAPGTVVDPALLREHLAAALPEHMVPGAFVQLAALP
TTPNGKLDRRGLPRPDFAAAAGSRAPATAAESLLCDLFGTVLGVERVGADDSFFHLGGDS
ILAFQVVAGARAAGLACVLPDIFRHPTPASLAAAAEQATVPPPADTALDADLAGVSAVDL
ERWRARYPDLTGVRPVSPLQAGLVFHSLLGDGSGTVPGAAGSDAYILQFVVDLRGRLDPA
RLRAAGRALFERHENLRTAFLYDGDAPVQIVLADLAPAAFDEVWTEVDLAGWPRAEALAE
AERLGRADRQTPFDLTAPPLVRFLLLRTGPDAWRLVLSPHHVVLDGWSVPLLLRELFRRY
ELAQSQSQAQADGPAAALPPAPSYWEYLRWLAGRDRDASRRAWAAALAGVTEPTLLAAAT
ARPGTPAQTAAHAPDQVPEQAPDQAVDQWDTVDGGVTAAVERHADAALTAGLGTFVRERG
LTLNTVLRAAWAVVLGRAVGRDDVVFGTSVAGRPAELPGAAEMIGLLLATVPVRVTLDPA
ESFVGLLDRVRADQTATLEHHHLGLADIHAAVGLPELFDTLFVLESYPFDPAGLLGPDSG
LRLEGLDGHDATHYPLTIRVIPGERLRITFGYRPELLSGATVTALADQLLDLLAAAIADP
DKPVGAIGAPAGSVAPAGTVGAAPAATRPEEDEPTGAWATDTTLPELFEAQAARVPDAVA
VTWGERRLTYAELDAAANRLARLLATRGVEPESLVAVALPRSIDLVVALLAVQKAGAAYL
PLDTAYPADRLAFMLSDAAPVCLVTSAEALPALPARTRVPMIALDAPPVVAALAEQSPAR
LPAAGRARPENAAYVIYTSGSTGRPKGVVVPHQTVTRLFAHTQPWFGFDETDVWTMFHSA
SFDFSVWELWGPLLYGGRLVVVDHHVSRSPELFLDLLRRESVTVLSQTPSAFSQLIEADR
AGGEDPAELALRYVVFGGEALDLGRLPAWYARHRDDAPVLVNMYGITETTVHVTYLRLDE
AVVAAARASLVGGPIPGLRVHVLDQHLRPVAPGGLGELYVSGGQLARGYLGRPGLTATRF
VADPFGGPGARMYRTGDLARRTADGGFEYLGRADDQVKVRGFRIELGEIQAAIATHPAVE
QAVVLAREDQPGQRRLVGYVVAAPGRRVDSEELRRHAAAMLPEFMVPVAVLALDAFPLTG
NGKLDRAALPAPDLASVSTGTRARTERERTLCAVFAGVLGLDEVGVDDDFFTLGGDSISA
IQLVNRARREQVGFTPRDVFTHRTPAKLAALTEPAASAVSTAPDGPAAFAGPGAAPDRPG
GAGTGLGADPEAIGVFTPLPIVSRLASWGGPVRRFNQAMLVSTPAGATVDLLRGAVQALL
DQHDALRARLLRPSPALWLLETLPVGSARAGDLLRRVDIAGLDEAGLRAAVAAESAAAAD
GLDPEAGAMLRVSWLDAGSDQPGRLLLVAHHLVVDGVSWRVLLADLRTAFAAVLAGRAPH
LDPVGTSLRAFARITAERAQDPARLAELAHWTATLAPGGRLLGGAPSTGAAAATGAAAAP
GAAPAAADTIADTDRLVVELPARATAPLLTSVPAAAGTDVTAVLLAALRAAVTGWRRERG
WDGSSDLLVDLERHGRDPIAPEVDLSRTVGWFTAISPVRLPASGDPASGDPASGGLASGG
LAGTLEAVAGRLREIPDGGAGFGLLRYANAAAAPVLAGAEHPEVLFNYLGRFGADAADAW
APAPELDALAAEPDPAMGVAYPLTVDAVSVQTPDGPVLRTTLTYLTTVIDRTAAGALATA
WLAALDGLAGLADDAVLAGAAAQADTAGPAAVTGADGAAGPAATGDLVELSPAERARVER
VSPGPVAEIWPLSPLQEGLFFHSAFDRSSDAYTAQFALDFGHRFDVDRLRRACETFMRRN
PTLRAGFLGDGLPAPLQFVVTELPAPLEETDLTGLPAAERAEQAELLARRDRERPFDISN
PPLWRLTLLRLGPDHDRLVFNRQVLVWDGWSGALVIDQLLGLYERGGGDEGLPVPAASYR
DFLVWLRARDTAGAEEAWRAALADLDGPTLVVPEARGLPPIEPERITTELAESTARAVRE
LSRRHGITVNTVFNAALALVLGNAVGSDDVVFGTTVAGRPTDVEGIDEVIGLFLNTVPVR
VRLDPRESVLDLLRRVQDQRVDVMDHEYLGLGDIQRASGRTQLFDTLYVLQNFIDEVATE
QSSDRFGITGGTSIDHTHYPLTFVLFPGTRITMRLEYRPDVVGAQRAAALFDRFRGLLDE
LVRDVTVPVGSVEVLLPAERAELAARWAEPFLPVGTETVADMLAAQVARTPDLTALVFGD
ERVSYADLDARVNWMARLLLARGAGPETVVALGLGRSVNMVVALFAVLRTGAAYLPLELD
HPPARLLGMVADAGAALLVATDATAAYLDGAGAGPDEPVPRLLLDDPAMAAELAATGAGE
LSDAELGLFARDRADRLDHPAYVIYTSGSTGRPKGVVTPYRGLTNMQLNHREEIFAPAVA
AAGGRRLRIAHTVSFAFDMSWEELLWLVEGHEVHVCDENLRRDAEALVAYCDAHQVDVVN
VTPTYAHHLFELGLLDRAEDGRHRPPLVMLGGEAVSEAVWNRLRDTADTAGYNLYGPTEY
TINTLGAGTADSPTPTVGRPIRNTRAYVLDGWLHPVPDGVPGELYIAGDGLARGYLDRFA
LTATRFVADPRVPGGRMYRTGDLVVRGAADGNLDFLGRTDEQVKIRGYRVELGEITAALD
RHPRVSQAAVVAADDTGAPGTRRLVAYVVPAELTAADRAAVEADQVGEWRQVYSDEYVQI
PTAVHREDFAGWDSSYDGQPIALEHMRQWRAATVERIRELAPRRILEIGVGTGLLLGQLA
PECDSYWGTDFAAPVIDKLRAETAGDPRFAGLELRCQPAHVTDGLPAGLFDTIVINSVVQ
YFPSPEYLRGVLRAALELLAPGGALFVGDVRNLARLRAFHIAIEVSRPGPGGLAEPAGGL
RDADLARLAPAVDRRVRLDKELVLAPEFFTALASETGAELSLRVKRGSFHNELTRHRFDV
VLRRPAAPPVRLGEAPVLVWGHQVAGTDAIEAHLRDRRPPMLRVAAIPDARVAGELALAA
RVAGRDVPGGAAAPECAVDAEHTVDPEELFALADRLGYEQHLTLSAAGPGLLDAVFVRAV
DVGAGPRVDGYLPDPAGGEAAPPLANDPTAARGAAALAALLRADLTTALPDYMVPAAYVT
LSEIPRTANGKLDVASLPPADPAVALVASRPASSPAEVTLCELYAEVLGLPEVGVEDDFF
ALGGHSLLATRLVSRARAAFGADLAIRDLFEAPTVAALAARVGAAGDEPAVSSRPPLVPA
DRPERIPLSPAQRRLWLVDRVAGGTNAYNYPLVIRLGGEIDLDALRAAAADVAARHEILR
TVIAEHDGEDYQRILDPAEAGPEVRFVDVAPACPGAPSAGAETGPAAEPSLDGPERPLEP
DELARLVERFVAEPFDLRTDPPLRLAVFRTSPAESVLAVVLHHIATDEWSDRPFLEDLDA
AYAARRAGREPDWDPLPVQYADYTLWQRELLGEPADPSSPAGRQLAYWEQALRGIPAEIE
LPLDRPRPAVRDGAGGREARELPAATVTALRGLCARTGASMSMLAHASTATLLHRLGAGD
DIPLGVPIAGRTDTALDHLVGFFVNTLVLRSDLSADPTFAELLARTRETDLAAFDHADLP
FEDVVAAVNPRRSAGRNPLFQVMTGYHHLADGEHTLLGLPTSWLRTEAGTVKFDLDVTFV
DRGGSDQITLLVEYARDVWDADTARRLADRLVDLLGQLARDPDRPVSRLALLGGDERRRA
LRSATGPRREPPQPTAVRLFAAAAAASPDRPALVAGGTKLTFAELAEQVGSLAWLLARRG
AGIEDVVALALPRARMVPALLGVMTAGACYLPIDTDHPADRLAFLLTDARPRLVLTTAAL
AGQLPATGAEVVVLDDPAVQAELAAHPAGLPIAGLPPAGQALRGDNAAYVIYTSGTTGRP
KAVVATHRGVTNLFASHEVELILPAVAAWGGDGPLRAVHAASFSFDGSWEPLLWLFAGHT
VHVADEATMRDPAALAEYVVNARIDFLDVTPTYLRELVHLGFLDGAHLPGVIAVGGEATP
APLWERLRTLPGVVAHDLYGPTEYSVDAYGWHGDGTAGPVANTRALVLDAGLEPVPDGVP
GELYLAGDGLARGYLGRPGLSATRFVADPFGAPGGRMYRTGDRARRRADGTLAFLGRVDD
QVKVRGFRIEPGEIEAALLALPGVAAAAVIVREDAAGDPRLVAYVVPDGPCATADPGVAV
PGPADPAAADRATGDRAVADLGALRSELARTLPSHLVPSAFVAVAELPRTVSGKLDRAAL
PAPGEPAAWPGRRPRGAREELLAEQFAAVLGTAEVLGTAEIGAEDDFFALGGHSLLAMRL
RSRIRSVFGVEVSARDIFDEPTVAGLARRLDGAVAAARPALAPADRPQRPPLSHAQARLW
VLGQVEGPSPTYNIPVTWRLEGPLDVGALRAAVGDVVTRHEALRTVFPAPDGVPHQRVLD
PAAARVDVELIELGSAGDLARRLENASARVFDLERELPVRVTAVRLDPRLHVVQFLVHHI
AADEGSDQALARDLSTAYRARLRGEAPRWAPLPVQYVDYTLWQRALLGDESDPASPASAQ
RDFWRRELAGLPVELAVPTDRSRPAEPSHRGGVVELTWDAELLDRLRATARAHDVSLFMV
LQALVATLLHRLGAGDDIPIGSPVAGRGDERLDDLVGFFLNTLVLRTDLSGPVSFGELLG
RVRAADLAAFDHQDLPFDRVVEAVNPPRSLARHPLFQVMVVHLPAAGAAAGLDLPGVTAR
PEPVRAATAKFDLSFDFLERVTEAGTTELAVGLAYSADLFDHATAASFGRRLQLLTEAVL
AAPTAPLAALPVLDDAERDLVLTGFNRTGRAVTELTWPAAFEAQADRTPGAVAVVCEDVE
LTYAELDARANRLARLLAARGAGPESVVAVAVPRSADLVVALLGVLKTGAAFLPLDLDHP
ADRVAFMISDAGARLLVSTRGHAEELIALGALGALGALGVPGPLGDPGAPGTGAPGLDLV
LLDEPGTAAELATGDPARPGTGVATSLDSAAYVIYTSGSTGRPKGVVVTHEGVGSLVATA
VDRLGVNGTSRVAQFASVGFDVAVFDLCMALCVGGRAIIVPAQRRVAGPELTGYLADHGA
THMILPPALVAALPADCALPAGAVLVVGTETVPIETVRRWSSHLRVVAAYGLTEATVNST
LWQADPDWTGAVPIGVPDPNTRAYVLDTALRPVGVGAVGELYIGGRGLARGYLGRPALTA
QRFVADPFGRPGDRLYRTGDRARWRPGGVLDFLGRADDQIKIRGYRIEPGEIQSVLMRHP
GVRQAVVLAREDRPGSLQLVAYVVPVDPAQTGPAPGGGRLDPAALRVHAAEYLPEYMVPA
AVVLVPGRLPMTPNGKLDRAALPAPRFALSAADRAPASATEARLCELFAELLGLGDSRRG
PAAEEQAGRQPAAAAVGVDDDFFALGGDSIISMRLVSRLRADGFVVRPAQVFRHRTPAEL
AAVLTGAGALSGTVATTGAGPLPGAVATAVASDGVGVVPPTPPLLALRAAGGGVDGFSSP
MLLHVPASVTLPALRAVLAAVAERHEILRARLVRAATGTVPDGLPATSADGGEAWYLDVP
PPGPAGVGSWVRRVEVGADDDLDRMLAAEALRANRELDPDAGAMVRVVWFDAGHSNSGRL
LVLVHHLVTDGVSWQIILDDLAAAWNALTRGGVPALAPVSTSYRRWALGVTEQARRPERE
AELAYWLRTVEGGAPLPRPEIPEVERAAPEHDTAVVERDAGAVTATIPETWAGDVLVVAP
AAWGVGADEILLAALALAVADCRRRWEGTQAAGLVVALQSHGRVDPEVDEADLTRTVGWF
ADVHPLCLDQRPVDLGDPAAGAALDAAVVAVHRRKAETPRGGSGYGLLRHLNPRTAPVLA
RAGQPAVYLNYEGRWSRPEPADWDVAREDEGLFAGWNSERADPFPLTVIIRALDLPGGLR
LVARWTSGAGGLPASAVGDLATAWTRALAALAARARHLR
Download sequence
Identical sequences A8LAS3
298653.Franean1_5940 gi|158317682|ref|YP_001510190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]