SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158317857|ref|YP_001510365.1| from Frankia sp. EAN1pec

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158317857|ref|YP_001510365.1|
Domain Number 1 Region: 25-338
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.8e-109
Family UbiD middle domain-like 0.000000125
Further Details:      
 
Domain Number 2 Region: 339-504
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 2.35e-54
Family UbiD C-terminal domain-like 0.000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158317857|ref|YP_001510365.1|
Sequence length 504
Comment UbiD family decarboxylase [Frankia sp. EAN1pec]
Sequence
MERPGTGYDQRPFVGAAKMDAMAWADLRAFLAHLDRSGDLRRVRVPVDPRLEVTEIVTRV
VRERGPALLFDKPLGSDMPLAINVFGTEARMAAALGVDRLDDVGTRIGEMLRPELPVGFG
GLRGALGKAAQLTSLPPRKVRTAPCQDVVLKGSDVDLNLLPGVHAWPRDGGPFLNLGLTH
TKHPETGARNLGMYRLQQHDARTVGMHWQIHKDSNAHHAVAERRGERLPVAIAFGCDPAV
TYAASAPLPAEIDEYLFAGFLRRERVEMVDCLTVPLQVPANAQVVLEGWLEPGERLPEGP
FGDHTGFYTPIEPFPALHVDVMTMQRDPVFQSIVVGRPPQEDGPMGKATERIFLPLIRMM
IPEIVDYDLPEAGVFHNCAIVSIEKRFPKHAQKVMNAVWGAGLLSLSKLIVVVDADCDVH
DYHEVAWRAFGNVDYAHDLLTTVGPVDHLDHASYEQFYGGKVGVDATRKLPTEGYRRDGG
WPEEIVMDEAVRDRVTRRWKEYGL
Download sequence
Identical sequences A8LCC2
gi|158317857|ref|YP_001510365.1| 298653.Franean1_6115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]