SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157150660|ref|YP_001450674.1| from Streptococcus gordonii str. Challis substr. CH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157150660|ref|YP_001450674.1|
Domain Number 1 Region: 54-226
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.85e-37
Family B3/B4 domain of PheRS, PheT 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157150660|ref|YP_001450674.1|
Sequence length 235
Comment hypothetical protein SGO_1394 [Streptococcus gordonii str. Challis substr. CH1]
Sequence
MNITVEKAFWEVFPEAQISVLVVKGLDNRVDESKDPYFKSLLDKGAKRAEDFILDENFTQ
NEVIQEWRQAFSKFKTKKGARSSIEALLKRVSQGREFHPINPLVDIYNSVSLSYAVPCGG
EDLDKIVGGLHLGKAKGGEAFFPLGAESDAPALPEEIIYYDEEGAVCRCLNWREAQRTML
TEETKDAILVIEAINKEQAGRAQVAMTELQSLIEEYFGIKGEITHLTAEHPNLEI
Download sequence
Identical sequences A8AY14
gi|157150660|ref|YP_001450674.1| WP_012130480.1.24227 467705.SGO_1394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]