SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157150935|ref|YP_001450160.1| from Streptococcus gordonii str. Challis substr. CH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157150935|ref|YP_001450160.1|
Domain Number 1 Region: 276-465
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.11e-67
Family B3/B4 domain of PheRS, PheT 0.00000886
Further Details:      
 
Domain Number 2 Region: 536-758
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 3 Region: 102-261
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.85e-43
Family Myf domain 0.0043
Further Details:      
 
Domain Number 4 Region: 768-865
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.31e-28
Family Anticodon-binding domain of PheRS 0.00087
Further Details:      
 
Domain Number 5 Region: 475-544
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.42e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157150935|ref|YP_001450160.1|
Sequence length 865
Comment phenylalanyl-tRNA synthetase subunit beta [Streptococcus gordonii str. Challis substr. CH1]
Sequence
MSLKSGFQRQIPKIWPVEFLSDRIEKGIEPGLKTRKKDRFASIHRMLEQISYFSVVFDAL
GILNMLVSYKWLKELVDIDVASAELAEKMSTTGIEVEGVTSPADGLSKIVVGEVVSCEDI
PDTHLHVCQVNVGEEENRQIVCGAPNIRAGIKVMVALPGARIADNYKIKKGKIRGLESLG
MICSLGELGISDSVVPKEFADGIQILPEEAVPGEEVFSYLDLDDEIIELSITPNRADALS
MRGVAHEVAAIYDKSVQFKDFPLVEDEKQAADSLSVALETEKAPYYAARILENVTIAPSP
QWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDTFEGDQIVVREARAGEKLVTL
DGEERELEVSDLVITVADKPVALAGVMGGQATEISGKSTRVVLEAAVFDGKSIRKTSGRL
NLRSESSSRFEKGINLATVNEALDAAASMIADLAGATVRAGIVSAGSLDISDVEVVSSLA
DVNRVLGTDLLYTDIVDVFRRLGFGLSGSAEQFTVSVPRRRWDISIEADLYEEIARIYGY
DKLPASLPKDDGTAGELTATQQLRRQVRTLAEGAGLTEIITYALTTPEKAVEFTLNPSNL
TELMWPMTVERSVLRQNMVSGILDSLAYNVARKNKNLALYEIGKVFEQTGNPKEELPNEI
NSFAFAFTGLVNEKDFQTQPVAVDFFYAKGVVEALFAKLGLTAEYAASSQIKSLHPGRTA
LISINGQPVGFVGQVHPATAKAYDIPETYVAELNLSAIEEQLQPAQPFTEITKFPAVSRD
VALLLKAEITHQEVLDAILAAGVKRLTDIKLFDIFSGDKLGVGLKSMAYSLTFQNPEASL
TDEEVAKYMEKIEKSLTEKLGAEVR
Download sequence
Identical sequences A8AWK0
467705.SGO_0861 gi|157150935|ref|YP_001450160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]