SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157960291|ref|YP_001500325.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|157960291|ref|YP_001500325.1|
Domain Number - Region: 100-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00123
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157960291|ref|YP_001500325.1|
Sequence length 159
Comment hypothetical protein Spea_0462 [Shewanella pealeana ATCC 700345]
Sequence
MEFSNPIIIWACIGVILVLAEIILPGGIVILLGAACLVVASALAIGLVEGIVQSLTLWFI
SSMVLLLTFRQVTQKLIGGDAHIGNTDEELDIYDQLAIVKQTIGPAQQMGRVEFQGCEWS
ALGDGSEIAAGSQVRVICRDNIALVVEPIKAEDEHYVEK
Download sequence
Identical sequences A8GZQ3
398579.Spea_0462 WP_012153728.1.79101 gi|157960291|ref|YP_001500325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]