SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157961404|ref|YP_001501438.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157961404|ref|YP_001501438.1|
Domain Number 1 Region: 253-400
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.95e-36
Family Aromatic dioxygenase reductase-like 0.029
Further Details:      
 
Domain Number 2 Region: 105-270
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 9.29e-35
Family Ferredoxin reductase FAD-binding domain-like 0.0065
Further Details:      
 
Domain Number 3 Region: 36-123
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.76e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157961404|ref|YP_001501438.1|
Sequence length 405
Comment Na(+)-translocating NADH-quinone reductase subunit F [Shewanella pealeana ATCC 700345]
Sequence
MEMAIGIGMFTFVVSILVMVILFAKSKLVSTGDVNIRINDDPDKSISTQAGDKLLGALAG
KNIFIPSACGGGGTCGQCRVKVKSGGGEILATERDHINKKEAKEGCRLACQVSVKTDMEL
EVEEEIFGVKKWQCEVISNNNQATFIKELLLKLPEGEDVLFKAGGYIQIEAPAHEVKYAD
FDIPAEYRDDWEKYDLFKLVSKVDEDVLRAYSMANYPDEKGRIMLNVRIATPPSDNIAPG
KMSSYIFNLKAGDKVTISGPFGEFFVKETDAEMVFIGGGAGMAPMRSHIFNQLKGVKTKR
KMSFWYGARSTREVFYQDDFDTLAAENDNFVWHVALSDPLPEDNWTGYTGFIHNVLYENY
LKNHKAPEDCEFYMCGPPIMNSSVIAMLESLGVEPENILLDDFGD
Download sequence
Identical sequences A8H2W6
398579.Spea_1578 WP_012154827.1.79101 gi|157961404|ref|YP_001501438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]