SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157959873|ref|YP_001499907.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157959873|ref|YP_001499907.1|
Domain Number 1 Region: 683-715,744-820
Classification Level Classification E-value
Superfamily TPR-like 0.000000000715
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157959873|ref|YP_001499907.1|
Sequence length 825
Comment hypothetical protein Spea_0043 [Shewanella pealeana ATCC 700345]
Sequence
MNTLDLRLEHQFFVNDFGEYYLPSVNRNTFKKIDSNTIFKQTFKDEIFQEDRLHIVIGTD
SGLLLNYILMNGIPSGSKYIFIEPAAVLDILNINIDAKFQQQVKLIEIEEFAKQLANDEY
DLYLIKNQYITHNSMASCDGIVEEYNTIIYNVQKQLTNLHYARNRLVRHKDFLIQQLRNI
ADNQYPASLLRNRFEGKSCIVIGGGPSLDEHMEWITKNYNQLFIITVSRVAAKLSKANIP
AHIIVSIDPHDISFEANIDTMALAQESLLINSYHINHRILSQWQGSSLYVGPRIPWSKAD
SDNVSSVGPTVTNSAVRIAIELGFSTILLAGADFCHSSTGASHAKGSVEADAGLNHSRID
EWVETYAGNKAETPVELLGAAQTLQIEAANHPTVNIINLSIDAAKLEGVNYQAAETVNLM
TTDMTPKQVLDLIETLIEDKSLYLDNMLTDLQLSTESLSDINKLSLQAIDLNLEIKSVSV
SSKKYRNIANKISRIEEQIDNQHGKFSYLVKEYGYVEFAKFLTTKESKHWTADEMQKMTH
LYYEAFKCLTEELLGYITDATNIIKTRQLELIKNVNLAELTRQWEQHNQPGRVHIFQKVR
TELGLSYDDTHECLTAAKANYHTQLTAKTHSYFSMKKTNSSLHNTLAKITDLYKSKNSAG
LQQLFHSIEPMIESDSLAQRLFYLAKSYVFILKEDNMAALSELQKIDEINQTEVILKQMI
ALASELQIIDVTVQSLAKITAFSNEYLPLYAHALTIQGDNIQAINTYLDYLDVMPNDTKV
RLSLGIFLLKIGQVDGAITCFKQVLTVDINNLSALSYLKQLVPTQ
Download sequence
Identical sequences A8GYI5
gi|157959873|ref|YP_001499907.1| WP_012153318.1.79101 398579.Spea_0043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]