SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157960271|ref|YP_001500305.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157960271|ref|YP_001500305.1|
Domain Number 1 Region: 80-351
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-41
Family SelA-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157960271|ref|YP_001500305.1|
Sequence length 496
Comment selenocysteine synthase [Shewanella pealeana ATCC 700345]
Sequence
MTQAINSTQALYRCLPAMDSLLLIPQVISFIDQQGKPWIKSLLAQMLQDARQHIAEQQSL
PSWCLDLSNIITELARRIAKAQRPSMTPVINLTGTILHTNLGRSQMCEAAIDAVTQVMRS
PVPLEFDMGQGKRGHRDSAISALIHELTGADTCCIVNNNAAAVLLMLAATAAGKEVIVSR
GELVEIGGAFRIPDIMAQAGCKLVEVGCTNRTHLKDYAAAITEDTAAIMKVHTSNYHISG
FTKVTEEAELAALCKERGIALISDLGSGALTDLSRFGLSKEPMPQQMLKDGVNLVSFSGD
KLLGGPQAGLVVGDAELIAKLQAHPLKRALRCDKMTLAALEATLMQYRNPTSLDTQLPIF
RKLSRPLAELETLAQQLTTVCSPVQTQFNVTIKPCQTQVGSGSQPDVLLDSIALCFSVNA
NAVKEHNSLSVLQLDKFFKAASLPIIGRITANQLWLDLRGTDNDTQLIEVLTKTLIEFEQ
AHINTLSVLPRVEAQS
Download sequence
Identical sequences A8GZN3
gi|157960271|ref|YP_001500305.1| 398579.Spea_0442 WP_012153708.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]