SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157960664|ref|YP_001500698.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157960664|ref|YP_001500698.1|
Domain Number 1 Region: 219-393
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000014
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157960664|ref|YP_001500698.1|
Sequence length 403
Comment hypothetical protein Spea_0836 [Shewanella pealeana ATCC 700345]
Sequence
MLNAENLCVESVMKRSILLLILQLTLCTLLVSGCASQGLKTSDDLTVYFHDEYFSPAQEL
PDADTLFELPEDALNSLRRELTRSKGYQHQSKVMLHEWLANYINAADGGFRYADNVTRSA
RDTFDDREGNCLSLVVLTAALAKELAVKVEFQEIDIPPVWDRQGGFYLVNGHINLKLLPQ
DKGNVFNISTQSIQIDFLPERAMQGYQKRRVSRAIVVSMFYNNIAAEALVEGNYDRAYGL
LKLALKQEELFLPALNTLAVLYRYKGLDQQAEVLYKYVLSVQPEDMNALNNYAIMLSAQD
RLDEWSDVHKVMELARIRNPYYYYGMAQQAYFDKEYQDALIWYKRAIAKADYRHEFYFGL
SRTYWVTGDLSRAEQSLEKALKLTTDEHNKRRYQAKLHAMRSH
Download sequence
Identical sequences A8H0S6
398579.Spea_0836 WP_012154097.1.79101 gi|157960664|ref|YP_001500698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]