SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157961639|ref|YP_001501673.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157961639|ref|YP_001501673.1|
Domain Number 1 Region: 187-360
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000313
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157961639|ref|YP_001501673.1|
Sequence length 380
Comment hypothetical protein Spea_1815 [Shewanella pealeana ATCC 700345]
Sequence
MRLIIICLLTIMLQGCQSRASTQGPTLPRIDYQVNAAKYSIPTPEDFYQLTDAQVKSIRS
FIEQEKFAELSPHRKVYALLESKLDNFDFRGENLYASDSLDSNSGNCMALAMLTYAIAKE
LDVEISFQVMHTIPVLLGVSGNISVTSDHVRSFLHEQGQDKDSFLGQTNRIRIDYFPDKY
DRGGMMIDSDEFFAMFYRNLAADAILDKQLELAYLLLNEALKFNDQYGPAINMQAVVLRQ
LGELDSAEQLYLYGLVVADEKIDLLSNYHFLLVHSERYQEAEKIKAQLLAFDHHSPYKWY
FQARDAMLAKDYSSAKTYLNKFLKNTHYYHKAYFDLARVEYQLGDTFAAKKSLNKALALS
AEAKDNDLYQAKLNWLSKTD
Download sequence
Identical sequences A8H3K1
WP_012155058.1.79101 398579.Spea_1815 gi|157961639|ref|YP_001501673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]