SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157962745|ref|YP_001502779.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157962745|ref|YP_001502779.1|
Domain Number 1 Region: 212-383
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000341
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157962745|ref|YP_001502779.1|
Sequence length 405
Comment hypothetical protein Spea_2927 [Shewanella pealeana ATCC 700345]
Sequence
MFAFIEKLSHTQRKYALILGSVSLILAAVLLWSLSDSQQPKLANGAIIVLPIKQQTDSYS
TDWQAYAHMEKVINQLGTSTNYPVLLVEDVITMLSQASSFIDDGQAIDLNRLFNVSGAAL
VVESSISTNSTNSSNSTNSTAPQLQLSYRLLNTEKIKQGVIKADSVDALLSALVETVKQF
IDVPYTQTANRDWFSDPLLIEALRQIQYRDIEQAKSSLQQLLTNDSTNLIATRLLAQLHI
DAQQLTAAEHLLNSAVEQAKSNNNRQLARLKLSLAQVKLGNEQLELAISELSQARSLAAN
TQDWLYLGYISNWSGHIYQRLNRYSNARAQYQYAFEYQNKSGYPAGQVTALNNLARLEVL
EHNYSAAYKAIKQSVAIVSQRQLTHLHEETFTLLSKIENKLQRIR
Download sequence
Identical sequences A8H6Q7
gi|157962745|ref|YP_001502779.1| 398579.Spea_2927 WP_012156149.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]