SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157963419|ref|YP_001503453.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157963419|ref|YP_001503453.1|
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157963419|ref|YP_001503453.1|
Sequence length 97
Comment SpoIIAA family protein [Shewanella pealeana ATCC 700345]
Sequence
MVSFNQQGINCTVSGCLDQEAVRSLWNGRSSILDPDTAFLWLSEIEYCDSAGVAFLLELV
STFAAKGASLKLVSPSEQLKKFIILYDLNDFFIEEAK
Download sequence
Identical sequences A8H8N1
gi|157963419|ref|YP_001503453.1| WP_012156802.1.79101 398579.Spea_3605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]