SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157963460|ref|YP_001503494.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157963460|ref|YP_001503494.1|
Domain Number 1 Region: 59-460
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.47e-62
Family Cystathionine synthase-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157963460|ref|YP_001503494.1|
Sequence length 461
Comment class V aminotransferase [Shewanella pealeana ATCC 700345]
Sequence
MNHKPEANLANAGRRGFLKTTTGVALAAVGTSLLPATAHASSDNHIEPFHGHGSGQGFWN
KVRNEFILNKRTTYMNIGTAGTMPKRVLKDYNRTNEQISINPWNSNIPTLDYAKQIAPSF
GADEHELVLCRNTTDGLCTIINGLQFEYGDIILTTNHEHHGVTTPLKHVAQRYGAEVIEL
ALPVYTPNNEVSSDDFVQVFNDAVSQYGNRVRLMVFSHVTFTTGTTLPAKRICQEVAIPN
GIITLVDGAHTPGMFNLDFHDIDCDFYSGAGHKWQCGPGATGFLYVRDNANRLFEFWSDR
ETPLWFINTSSSAAEVQTKLQSVGQDNYPAKRALADACALWDEIGRDAIEERILDLSALC
KKQLAKKFPEAMIFAPNIRELSSGLTTFNPFDDLNDGELLTEFRDRLHEEYGYIVRTTSF
YLDQYDTVKTYSLRISTHLFHDEDDVKGLVKAMKQLHREMR
Download sequence
Identical sequences A8H8S2
WP_012156843.1.79101 398579.Spea_3648 gi|157963460|ref|YP_001503494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]