SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157963578|ref|YP_001503612.1| from Shewanella pealeana ATCC 700345

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157963578|ref|YP_001503612.1|
Domain Number 1 Region: 234-407
Classification Level Classification E-value
Superfamily TPR-like 4.93e-16
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157963578|ref|YP_001503612.1|
Sequence length 428
Comment hypothetical protein Spea_3766 [Shewanella pealeana ATCC 700345]
Sequence
MSVINKMLKDLDERQQPHGIESMAAPQLAFKPKSSSKRTLLLTSIVSLAIGGFAMFFGLS
LMHPQTTNAETARAKTAKMETARAKIAETETAETKAVNATVAETETVKAEITEAETVKVE
TVKAETVKAETVKAETAKAETVKAETVKAEIVKAEIVKAEIAEAEIVKAEIAEAETAKSK
KAETEVAKAKTAKTEAVNVTVAETEKPVPAQLNIAPASRSRQLHSSGNMAVREVKLSPEQ
LAQKQMLLATDAQQQGLHSDALTYYEAALMYNPALHQARRQVAALYYGQNKLAKAAKILE
QGQLLFPQEYEFSLLLARVQQAGGQSELALKSLAMIPDSSDLALKKWHQQSDLAQKQKDF
PTAEQSFRQLAKHEPNQGRWWMGLAYALDAQQKYTEAKSAYNQALSQGNLSVQAKVYVDN
RLLQLGAY
Download sequence
Identical sequences A8H940
WP_012156959.1.79101 398579.Spea_3766 gi|157963578|ref|YP_001503612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]