SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163868875|ref|YP_001610101.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163868875|ref|YP_001610101.1|
Domain Number - Region: 7-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0385
Family MarR-like transcriptional regulators 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163868875|ref|YP_001610101.1|
Sequence length 118
Comment phage-like protein [Bartonella tribocorum CIP 105476]
Sequence
MKADMDKIIREEARLIILKGLACERSETLSSAMIERLLYSYGIRRDGDFVRNELAFMEEQ
GAVTLKCVGSVLLAALTERGARHLDRSFFIEGIKRPKRSSIKDEVRDAQGRAWTLNSD
Download sequence
Identical sequences A9IX44
WP_012232190.1.76171 WP_012232190.1.90605 382640.Btr_1828 382640.Btr_2630 gi|163868875|ref|YP_001610101.1| gi|163869320|ref|YP_001610576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]