SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163867407|ref|YP_001608604.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163867407|ref|YP_001608604.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000907
Family Replication initiation protein 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163867407|ref|YP_001608604.1|
Sequence length 108
Comment hypothetical protein Btr_0119 [Bartonella tribocorum CIP 105476]
Sequence
MQNALICTGYGLILSEKRIVMIAIFKLDMLYHRSNDVPTTRIIAAECVELAECEMHTAYE
SLQSAYKKLYQRSITFYEPAYIRKGKSISSTEFKMRWVWQTHYQKAID
Download sequence
Identical sequences A9ILW4
gi|163867407|ref|YP_001608604.1| 382640.Btr_0119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]