SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163867492|ref|YP_001608691.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163867492|ref|YP_001608691.1|
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.08e-38
Family FUR-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163867492|ref|YP_001608691.1|
Sequence length 137
Comment ferric uptake regulation protein [Bartonella tribocorum CIP 105476]
Sequence
MNKKRNYEQELRAAGLRVTRQRRVILDILADTNDHPNAFEIFQRANKIDSSISLSTVYRT
MKKLEVNGTIHRHTFSGGPSRFEQADGQHHDHLIDIETGQVIEFHSDVIEKLQEEIAKSL
GYNIVHHRLELYGKKNS
Download sequence
Identical sequences A9IMM6
382640.Btr_0216 WP_012230608.1.76171 WP_012230608.1.90605 gi|163867492|ref|YP_001608691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]