SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163868066|ref|YP_001609270.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163868066|ref|YP_001609270.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.97e-35
Family Transcriptional regulator Rrf2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163868066|ref|YP_001609270.1|
Sequence length 144
Comment iron-responsive transcriptional regulator [Bartonella tribocorum CIP 105476]
Sequence
MRLTKQTNYALRMLMYCADNQGSLSRVSEIAKAYAVSELFLFKILQPLVQAGFIQTVRGR
NGGVKLAKPATEISVADVLKVTEDNFSLAECFDNAEPTCPLIDFCSLNIALQKALSAFFD
VLSVISLADLQRPSFHNHFKVNKQ
Download sequence
Identical sequences A9IS90
382640.Btr_0871 WP_012231426.1.76171 WP_012231426.1.90605 gi|163868066|ref|YP_001609270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]