SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163868807|ref|YP_001610031.1| from Bartonella tribocorum CIP 105476

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163868807|ref|YP_001610031.1|
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-23
Family FUR-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163868807|ref|YP_001610031.1|
Sequence length 130
Comment FUR family transcriptional regulator [Bartonella tribocorum CIP 105476]
Sequence
MSSKLTRNQILVLNTLKNAKGPLSAYAILDQLREEGFRAPLQVYRALEKLVQLKCIHRLE
SVNAFMVCLHPEKCQHELTTFIICENCGTVNEIQNQMIVSSLKQMVQAIDFQAHKSTLEV
RGLCKKCATK
Download sequence
Identical sequences A9IWT0
382640.Btr_1745 gi|163868807|ref|YP_001610031.1| WP_012232148.1.76171 WP_012232148.1.90605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]