SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161870257|ref|YP_001599427.1| from Neisseria meningitidis 053442

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161870257|ref|YP_001599427.1|
Domain Number 1 Region: 38-532
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 7.19e-175
Family Type II DNA topoisomerase 0.0000000000194
Further Details:      
 
Domain Number 2 Region: 544-719,758-900
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 7.32e-96
Family GyrA/ParC C-terminal domain-like 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|161870257|ref|YP_001599427.1|
Sequence length 916
Comment DNA gyrase subunit A [Neisseria meningitidis 053442]
Sequence
MTDATIRHDHKFALETLPVSLEDEMRKSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAM
HELKNNWNAAYKKSARIVGDVIGKYHPHGDIAVYDTIVRMAQNFAMRYVLIDGQGNFGSV
DGLAAAAMRYTEIRMAKISHEMLADIEEETVNFGPNYDGSEHEPLVLPTRFPTLLVNGSS
GIAVGMATNIPPHNLSDTVNACLRLLDAPDTEIDELIDIIQAPDFPTGATIYGLSGVREG
YKTGRGRVVMRGKTHIEPIGRNGEREAIVIDEIPYQVNKAKLVEKIGDLVREKTLEGISE
LRDESDKSGMRVVIELKRNENAEVVLNQLYKLTPLQDSFGINMVVLVDGQPRLLNLKQIL
SEFLRHRREVVTRRTLFRLKKARHEGHIAEGKAVALSNIDAIIKLIKESPNAAEAKDKLL
AHPWRSSLVEEMLTRSGLDLEMMRPEGLAANIGLKEQGYYLSEIQADAILRMSLRNLTGL
DQEEIVESYKNLMGKIIDFVDILSKPERITQIIRDELEEIKTNYGDERRSEINPFGGDIA
DEDLIPQREMVVTLTHGGYIKTQPTTDYQAQRRGGRGKQAAATKDEDFIETLFVANTHDY
LMCFTNLGKCHWIKVYKLPEGGRNSRGRPINNVIQLEEGEKVSAILAVREFPEDQYVFFA
TAQGLVKKVQLSAFKNVRAQGIKAIALKEGDYLVGAAQTGGADDIMLFSNLGKAIRFNEY
WEKSGNDEAEDADIETEISDGIEDETADSENALPSGKHGVRPSGRGSGGLRGMRLPADGK
IVSLITFAPETEESGLQVLTATANGYGKRTPIADYSRKNKGGQGNIAINTGERNGDLVAA
TLVGETDDLMLITSGGVLIRTKVEQIRETGRAAAGVKLINLDEGETLVSLERVAEDESEL
SDASVISNVTEPEVEN
Download sequence
Identical sequences A0A076UBP3 A9M034
374833.NMCC_1298 gi|161870257|ref|YP_001599427.1| WP_012221781.1.10028 WP_012221781.1.11132 WP_012221781.1.11805 WP_012221781.1.15053 WP_012221781.1.24407 WP_012221781.1.42572 WP_012221781.1.48136 WP_012221781.1.55176 WP_012221781.1.60113 WP_012221781.1.68040 WP_012221781.1.75448 WP_012221781.1.82998 WP_012221781.1.8554 WP_012221781.1.9441 WP_012221781.1.98186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]