SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163846825|ref|YP_001634869.1| from Chloroflexus aurantiacus J-10-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163846825|ref|YP_001634869.1|
Domain Number 1 Region: 14-397
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 9.81e-112
Family ArgJ-like 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163846825|ref|YP_001634869.1|
Sequence length 398
Comment arginine biosynthesis bifunctional protein ArgJ [Chloroflexus aurantiacus J-10-fl]
Sequence
MNFTIFEDGHIASPTGFRATGVSAGLKEGSKARDLALVYSQYPCRAAALFTTSVFKAAPV
FLSQAILLRNHDAIRAVLINAGQANAGTGQSGLNDAIECAKITADELEVPRDSVLLMSTG
LIGVPLPMQRMRNGIRRAVSELDSNGGRRAALAILTTDTRPKERVLRVTLRNGPRFTLAG
MAKGTRMIHPRLATVLALITTDLAISQPLLQRALHQSVERSFNRLNIDGDCSPNDSVIML
ANGAIDHPPITDSSTWEFGVFQEALDFLCADLAGQIVRDAAGSGKVIKVVVQGAADEAAA
SAIAHTVARSGSVRAACRRHSSDWGALLAAIGASNVELRPDLLDLRIGTVPVMLRGAPVP
FDPTMLVQTMSGPEIELLIDLNLGPAETTVWTCTWTDG
Download sequence
Identical sequences A9WK29
gi|163846825|ref|YP_001634869.1| 324602.Caur_1252 480224.Chy400_1372 WP_012257136.1.35445 YP_001634869.1.55443 gi|222524647|ref|YP_002569118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]