SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163847469|ref|YP_001635513.1| from Chloroflexus aurantiacus J-10-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163847469|ref|YP_001635513.1|
Domain Number 1 Region: 117-199,230-392,528-656
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-52
Family Subtilases 0.00021
Further Details:      
 
Domain Number 2 Region: 418-518
Classification Level Classification E-value
Superfamily PA domain 0.0000000183
Family PA domain 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|163847469|ref|YP_001635513.1|
Domain Number - Region: 679-757
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0863
Family (Pro)aerolysin, pore-forming lobe 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163847469|ref|YP_001635513.1|
Sequence length 1053
Comment peptidase S8/S53 subtilisin kexin sedolisin [Chloroflexus aurantiacus J-10-fl]
Sequence
MSLSTKRHLLAVIISIGLTIALIAPSAAQPPRPLPNLESLRLEEPVTLTSAPTALSPSLI
GVSGRQQVVIRLSENPTARVPEGAAQAAQLQRITQQQDRVLSRLRAIDPTLVEVARLRVA
LNAVIAEVDGTALPALARDAEVVRINPVVNYERATQPPMETVPYIGATPDVQAAGFRGKD
VRVAVLDSGIDYTHAAFGGPGTLEAYQAAYGTSPSDSRNKTLDGLFPTDRVKGGYDFVGE
VWPNGPLAPDPDPIDCGAPGLSSGTCAGGHGTHVADIIGGEQGVAPEVDLFAVKVCSAVS
SSCSGVAILQGLDWSADPNGDGVTDDRMHIVNMSLGASYGQNYDDDSAIAVDNLQPLGIL
VVASAGNSADRPYITGTPAGARTALSVAQTAVPSDASYPITVLSTTVYGIAQPWAPIPNT
PVNGTLVYGASLGNALGCTAYPAGSLTGQILLVDRGVCAISIKGSNGAAAGAVAVIVANN
AAGAVPPTFSFGGGTPTVPVLSITQAAGNALKARVGNATTIGFDTPATNAGSVVGTSSRG
PTLGQMTYGDQIMYGQIIKPEIGAPGASLSAVAGSGTGVEPFGGTSGAAPMVAGAAALLY
NAVDWSFAPWELKARLINTAETNIFNGPPVFVGPALAPITRIGGGEVRINRAIAAQASAW
ELSNGTATISFGLVEATRNPTTLRRTIVIRNYGNSPLTYTITPTFRFANDAATGAITPST
SVTTITVPPRSRRTFTLTLRIDPTKLPAWVLNSGSNGGNGAALTAVEFDGYLVLDAPGTT
NDLTMPWHVLPRASGNVRAPASVRATTSTPATARLTNNGANPVSVDPFTLIGENPFVSAS
PGAGMQMPPMDLKYVGVRAFDGTGFCPANSPVIQFAVTTHQQITHSNYPVEIDLLFDTNR
DGTPDYVGFTAELSLPSGAFAADGRNAFFVGPLSGPYSAFFFTGHATNSANTVLTMCGSQ
IGVAGLGQQINVDAYTYDNYFTGFELSKIEGMSTVLGAPRFDIDVGSGVVPANGSLNTTI
YRFNAPADVTDSGILLQYSFAPGGREASAIIVR
Download sequence
Identical sequences A9WDW5
gi|222525320|ref|YP_002569791.1| 324602.Caur_1909 480224.Chy400_2062 gi|163847469|ref|YP_001635513.1| WP_012257778.1.35445 YP_001635513.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]