SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163847791|ref|YP_001635835.1| from Chloroflexus aurantiacus J-10-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163847791|ref|YP_001635835.1|
Domain Number 1 Region: 4-319
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.59e-68
Family DmpA-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163847791|ref|YP_001635835.1|
Sequence length 320
Comment peptidase S58 DmpA [Chloroflexus aurantiacus J-10-fl]
Sequence
MIIPAITAVQGVLVGQVADQDALTGVTVVLTPNGATAGVDVRGGAPGTRETDLLNPVNLV
QQVHAVVLTGGSAFGLAAATGVVSWLHERGYGFDVGLTKVPIVPAAVIFDLGIGRSDVWP
DATMGYAACMAAEAAVAEGSVGAGIGATVGKVGGMATAMRGGVGSWSETLADGVTVGALA
VVNAFGDVVDDHGRIIAGARAPDQSLIGTSALLRSGLSRRSFADTTGQNTTIAVVATDAR
LDKAAATRLAMMAQDGLARAIRPAHSPFDGDTVFALATGVYEAPPLVTLGAVAADVLATA
IMRAVQAATAAAGVPAARDL
Download sequence
Identical sequences A9WFU6
gi|222525659|ref|YP_002570130.1| 324602.Caur_2237 480224.Chy400_2410 gi|163847791|ref|YP_001635835.1| WP_012258100.1.35445 YP_001635835.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]