SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163847918|ref|YP_001635962.1| from Chloroflexus aurantiacus J-10-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163847918|ref|YP_001635962.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.09e-56
Family Ribosomal protein S7 0.00000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163847918|ref|YP_001635962.1|
Sequence length 157
Comment 30S ribosomal protein S7 [Chloroflexus aurantiacus J-10-fl]
Sequence
MPRRGNIERRPIPPDARYNSVLVQKFINKVMERGKKSLAERIVYQALDLAAERLKKPQME
IFEQALRNASPSIEVRPKRVGGATYQVPVEVKSDRRYSLAMRWLLMSARARTGKPMVERL
AAELIDAYNNTGTTIKRKEDVHRMAEANRAFAHYGRL
Download sequence
Identical sequences A9WH61 B9LJC7
gi|222525798|ref|YP_002570269.1| 324602.Caur_2364 480224.Chy400_2551 WP_012258227.1.35445 YP_001635962.1.55443 gi|163847918|ref|YP_001635962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]