SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163846298|ref|YP_001634342.1| from Chloroflexus aurantiacus J-10-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163846298|ref|YP_001634342.1|
Domain Number 1 Region: 181-470
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.35e-84
Family Cryptochrome/photolyase FAD-binding domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 3-189
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.35e-47
Family Cryptochrome/photolyase, N-terminal domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163846298|ref|YP_001634342.1|
Sequence length 510
Comment deoxyribodipyrimidine photo-lyase [Chloroflexus aurantiacus J-10-fl]
Sequence
MYIQLVWFKRDLRLHDHPALSAAAARGPVLPLYIVEPSLIHAPDFAARHWTFIRGCLVEL
RANLARLGQPLVVRVGEAVEVLDHLVSTWPIEAIWAHEETGNLLSYARDRAVRRWARARG
IPFHELPQNGVVRRLPSRDEWQARWEERMAAAQAQPPSALPPLAIDPGTIPTADELSLPP
DTLSEHQPAGETAALQTLTDFIHRRSQQYHRALASPLTAWEGCSRLSAYLAWGALSIRTV
VQATRHRISELAFDPSPATRGWVRALNAFESRLHWHCHFIQKLEDEPEIEVRNLVRAYDG
MREENHRPDLLVAWASGRTGYPFVDACMRALTATGWLNFRMRAMLVSFVAYDLWQHWREP
ALILARRWIDYEPGIHYSQMQMQAGTSGNRTIRIYNPVKQGIDHDPEGIFIRRWVPELAH
VPTPYIHTPWLLDRHGQERAGCRIGRDYPAPIVDHEAAYRRARAAIAAVRARPETAQEAA
AVHQRHGSRTWRPQRRPSKTVSSRQLRLDL
Download sequence
Identical sequences A9WFL5
gi|222524057|ref|YP_002568527.1| gi|163846298|ref|YP_001634342.1| WP_012256609.1.35445 YP_001634342.1.55443 324602.Caur_0714 480224.Chy400_0772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]