SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163846637|ref|YP_001634681.1| from Chloroflexus aurantiacus J-10-fl

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163846637|ref|YP_001634681.1|
Domain Number 1 Region: 141-243
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.41e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0011
Further Details:      
 
Domain Number 2 Region: 22-131
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000162
Family Histidine kinase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163846637|ref|YP_001634681.1|
Sequence length 249
Comment anti-anti-sigma factor [Chloroflexus aurantiacus J-10-fl]
Sequence
MESITLTADLDALAKTSAFITAAAERCGLDERATWQVQLAVDEAVTNVIQHAYDPDQPGD
FTLSWQCHDQRFIVTVRDHGRQFDPSTVPVPDITSPLEERQVGGLGIYLITRLMDEVHFE
FSPQGGNLLTMVKYLPSDQAEEANEVVVIPINDRIDALTAPRLSKTVNEQISQGARQIVL
DFSNVPFLSSSGLRALLLIRKELMTLGGELRLAALQPQVHEVFTITGFTQVFNIHPSVTE
ARAAFSQRR
Download sequence
Identical sequences A9WIJ2
gi|222524434|ref|YP_002568905.1| gi|163846637|ref|YP_001634681.1| 376066 WP_012256948.1.35445 YP_001634681.1.55443 324602.Caur_1060 480224.Chy400_1158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]