SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157164517|ref|YP_001467674.1| from Campylobacter concisus 13826

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157164517|ref|YP_001467674.1|
Domain Number 1 Region: 48-513
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 3.4e-86
Family Nitrous oxide reductase, N-terminal domain 0.00000204
Further Details:      
 
Domain Number 2 Region: 529-641
Classification Level Classification E-value
Superfamily Cupredoxins 6.03e-26
Family Nitrosocyanin 0.0022
Further Details:      
 
Domain Number 3 Region: 762-859
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000000438
Family monodomain cytochrome c 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157164517|ref|YP_001467674.1|
Sequence length 862
Comment methyl-accepting chemotaxis protein [Campylobacter concisus 13826]
Sequence
MQKLFCVASAALLGLSLTAACAASSDLEKVMKERGLSEKDVLAAAKTYQPSGKKDDFIVF
SSGGQSGQVLVYGVPSMRIYKYIGVFTPEPWQGYGYDNESKAVLKQGNIRGKEITWGDTH
HPNFTEKNGEYVGDYLFINDKANPRIAVINLKDFETTQMVVNPIMKSEHGGSFITPNSEY
VIEASQYAAPLDDNYHSMDDYEAVYRGAVTFWKFDYPKGKIDEKASFSLELPPYWQDLSD
AGKGESYGWGFTNSINTEMYTGGIEKGLPPFEAGASRNDTDFLHVYNWQILEKLAQDKKN
YKVINGHRVITIEAAVKAGALFLIPESKSPHGCDVTPDGRYIIVGGKLDTHASVYDFKKI
KELIDKKEFAGTDPYGIPILDREKSMHGQVELGLGPLHTSFDSQDGILYTSLYVDSQIVK
WDYKNLKVLDKVNVHYNIGHLDTMEGKSAKPKGKYAIALDKLSIDRFNPVGPLHPQNHQL
IDITGAKMDLIYDMPIPLGEPHDVVSIAASKLTPALTYNMGTNSRTGEASPYATLAGQER
VERNGKNVTVYATMIRSHINPEHIEVNKGDNVTIHLTNLERAQDETHGFGIDLYNIHASL
EPGKTASVNFVADMEGVFPYYCTEFCSALHLEMMGYLLVKDPNKKYESAKNSKLKTLSPE
ALKAEYDKVIATNKATDDVIQEVVKYLKEKHYEKYPKVKALVDDALDQYGHIKEVKAKAD
EAYKKGDVNGAILWEYQVWQYMVKTADVGLRAKNNLAKEIATPMSPAAAKGEEAYLKGGC
NGCHVIGQVSSGPDLTGVLLRHENGEKWVADFIKDPAKFYNDDYVKAMIDFFKLRMPNQH
MSDEEIKNIIQYLKWIDENAGM
Download sequence
Identical sequences A7ZFW6
WP_012140537.1.99898 gi|157164517|ref|YP_001467674.1| 360104.CCC13826_1729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]