SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157165223|ref|YP_001466764.1| from Campylobacter concisus 13826

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157165223|ref|YP_001466764.1|
Domain Number 1 Region: 183-260
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000122
Family Anti-sigma factor antagonist SpoIIaa 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|157165223|ref|YP_001466764.1|
Domain Number - Region: 236-421
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0301
Family Cytochrome P450 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157165223|ref|YP_001466764.1|
Sequence length 457
Comment prephenate dehydrogenase [Campylobacter concisus 13826]
Sequence
MKVTFEGSLAIVRPFGFLEVNITPSSIKKAEVEQICARQISAILLSLKNVTFFSPLWLNS
TCEHLSSIAREIGAEFAVCDYDDTFYELVAKTSKNILRFSLFENEKVATLFLNDTLADSS
EAIVIYNKNEQYKDYINSLLEQKCYKCKFVKSVEEFNAAKQAYKYTISTLNHIVLGKKEF
SAFIRGDVVIYKTAGLIDSSFVQKFDYKFHERLQKVGFKFFVFWSDSVGALNTIGASFLI
KLSELSQKSGGILAICGLNEGNISETLASNLKAAKILLYKKMDDFFKDDSTLYFKKRLID
IEPTKMNKSLVEFLPLVISSVTDVLSPLIESEILCLDAKISNFNVEGENDYLRACVLFYG
DVQMRILLGVKKDKLSKICSIFSDNGDLECGCLSGFSQIFSIIASKILDIFIERNLKVKL
SNFKFYENEMFFDRASSGIFATLNAKESQTGMIFISK
Download sequence
Identical sequences A7ZDA6
gi|157165223|ref|YP_001466764.1| 360104.CCC13826_1343 WP_012001699.1.99898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]