SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|157165489|ref|YP_001467343.1| from Campylobacter concisus 13826

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157165489|ref|YP_001467343.1|
Domain Number 1 Region: 204-402
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 9.42e-21
Family Peptidoglycan hydrolase LytM 0.031
Further Details:      
 
Weak hits

Sequence:  gi|157165489|ref|YP_001467343.1|
Domain Number - Region: 22-112
Classification Level Classification E-value
Superfamily Tropomyosin 0.0173
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157165489|ref|YP_001467343.1|
Sequence length 405
Comment transaldolase [Campylobacter concisus 13826]
Sequence
MKKGIFTLLLAFSLAFTSNTKEKIKDSKNSLRSTQAMSEQLSKKLDDLAGDIVNGEKKLR
GISGDITNLKGQISVLETNASKALLELDDLTKQNKELERTQKELEQNMIRIIAEDLSFDL
MMSASEGKQSEESIISSQILTKLNAIAKEDFKRLSENYEDTIEKIKNKSSKINEINSSIK
NYRRKQNDLQSLESTQKNTINGLKRDKEIYSKKLAKLQAQQDELRKTLEQLAIMQKQEDE
AARAAREKQERAASKGGKKGEKSQPMGGGYQTSSVKRYSGARTIAPLDSYSVKQKFGNYV
DPIYNIKIFNESVILRSSTPDAKVKSVLNGKVVFAKATPMLENVVIIENENGIHTIYAHL
SQIAPTVKVGSVVQKGYVIGRVRNDLTFEVTQRNYHIDPLEMISK
Download sequence
Identical sequences A7ZEY5
WP_012140230.1.99898 360104.CCC13826_0503 gi|157165489|ref|YP_001467343.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]