SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160903069|ref|YP_001568650.1| from Petrotoga mobilis SJ95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160903069|ref|YP_001568650.1|
Domain Number 1 Region: 287-600
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 9.29e-53
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000985
Further Details:      
 
Domain Number 2 Region: 1-180
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.75e-39
Family H-NOX domain 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160903069|ref|YP_001568650.1|
Sequence length 604
Comment methyl-accepting chemotaxis sensory transducer [Petrotoga mobilis SJ95]
Sequence
MKGMIVETWMETWKNTYGEDYVNQLLTEIGIPKDKHFSPFEDLEDSKVFKLLDLMSKTTN
KSKEELMKELGKKNIYTFKKYYPNFFRKKGLLSFLSTMNDVHKSLTRRIKGAKPPAIEFE
IIDSNSAYITYRSFRDMRYYFLGLLEGSAEVFGEKIEYEIIDQGNTDQGSFLKIKLKSEK
PYAKIKKARFFTAMSLSLMKMFFTSLTFYTIIIVFLLSWLFTWILGNHWYTFLITGILSG
AFILSMGNYFKRLFSSSSEGLQNLNNLEYDKPVLLKGEKMLEKHSLEIDNLRSNFNGIFI
QLTGDIEEIETFTEKVGERAEEMKEISDSIGELVEQVAISSEQIAQDAESISNVVEVNVN
TIQSIISREDQMVDSLENAVKRINDSSSKVEASSKEIENMSERFNNLVKESDKLEEDTKE
ILKVVDTVKGIADQTNLLALNAAIEASRAGEAGRGFAVVADEIRKLAEESKIAASQIDNI
LSRISSGIQLLTETVEKEFKAMREGANNLRISSLNNKESATNIKNISKEIHEILNELSSE
GVKLEDLTKNTQNLLAISEEGSATAEEISSSVKTFVNNIKEILQNIKEVDRFISSLKESL
SNKN
Download sequence
Identical sequences A0A2K1NAW6 A0A2K1NU47 A9BI36
WP_012209424.1.6947 gi|160903069|ref|YP_001568650.1| 403833.Pmob_1633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]