SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|160902039|ref|YP_001567620.1| from Petrotoga mobilis SJ95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160902039|ref|YP_001567620.1|
Domain Number 1 Region: 80-144
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000017
Family NfeD domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160902039|ref|YP_001567620.1|
Sequence length 156
Comment hypothetical protein Pmob_0563 [Petrotoga mobilis SJ95]
Sequence
MGQWGVWVIFAIIFAIAEAILPSFFFLWFAIGAGVAAITSLFISSVVLNLLIFLIVSFLL
WISTRKIVQNMYKGSSTIKPYQDQFVGMKAKVDKIGDEGRIIVKIKGDEWRAFPEDEENY
LINVGDDVIITRKTANFVYIKKINASENNQKKETGE
Download sequence
Identical sequences A9BH67
WP_012208401.1.6947 403833.Pmob_0563 gi|160902039|ref|YP_001567620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]