SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX98913 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBX98913
Domain Number - Region: 9-77
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00889
Family MgtE N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CBX98913
Sequence length 145
Comment pep:novel supercontig:ASM23037v1:FP929134:1303825:1304455:-1 gene:LEMA_P081520.1 transcript:CBX98913 description:"Predicted protein "
Sequence
MLSWQKETLVHALEAVEVLEAVQVLEAVQVLEAVQVLEAVQVLEAVQVLEAVQVLEAVQV
LEAVQVLEAVEVLEVLGSSGSQPPRPMAEHPGNAGSAGSATVFIKKIVRHRRWRKLELTM
TLPTFSRIPLCQRPHRKRTTSSKTC
Download sequence
Identical sequences E5A5L5
XP_003842392.1.65998 CBX98913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]