SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBY01265 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBY01265
Domain Number 1 Region: 8-190
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-35
Family ALDH-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBY01265
Sequence length 203
Comment pep:novel supercontig:ASM23037v1:FP929139:266667:267339:-1 gene:LEMA_P000520.1 transcript:CBY01265 description:"Putative uncharacterized protein "
Sequence
MADTTTTTTTTIPPFEHTPLEDIASTCATVRASFLAHKTRPLEFRIRQLRKLYWGFKDNE
ALVIEACKRDLGKAEFETYLTEFSWCMNDCVWMADNLTRFAQDEKPADIPLTNRLVGPRI
RKEPLGAALIIGAFNFPIQLTIGPLIGAIAAGCTAVIKPSEAAPHAAVVMAKIMRESLDG
SCYACVQGAPTSARSSRRRRPRH
Download sequence
Identical sequences E5ADH6
CBY01265 XP_003844744.1.65998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]