SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBY01813 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBY01813
Domain Number 1 Region: 6-167
Classification Level Classification E-value
Superfamily CinA-like 8.89e-35
Family CinA-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBY01813
Sequence length 173
Comment pep:novel supercontig:ASM23037v1:FP929139:2241826:2242402:-1 gene:LEMA_P006000.1 transcript:CBY01813 description:"Similar to competence/damage-inducible protein cinA "
Sequence
MSTAFPPEELKQVIQEIATLLKERKETISVAETAAGGLISASLLSFPGASTYYKGGLTLY
TLESRIAFAGWTDAHIKDYKGPTPVIVSGLAEHTRKTLGSTYTLSESGTAGPTGGQTRNR
TPGYCALAVAMEGRKTVTREIETGTSEREGNMVRFALEGLKLVRDVIKGDGKL
Download sequence
Identical sequences E5AF24
CBY01813 XP_003845292.1.65998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]