SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX94134 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX94134
Domain Number 1 Region: 494-523,563-622
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000255
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CBX94134
Sequence length 693
Comment pep:novel supercontig:ASM23037v1:FP929116:2220930:2223119:1 gene:LEMA_P038080.1 transcript:CBX94134 description:"Similar to sulfate permease "
Sequence
MDYLTNVGRSTREAIATDTTLQRTVRYGRNALLAAPSVAGQYLMEKAPVIQWLPSYKPRW
ILNDALAGITVGVLLIPQSLAYAKIATIPGEFGLMSSWLPNFLYFIMGTSKDLSTGPTSL
MGLLTAEIIRDVSKDGYTPQAIASAVAMSVGIYSMAIGLLKLGFLLEFISVPVLSGFISA
AAIVIMLGQIPSLFGITVPTGTAKIIHDLFAKIPQYDGPTTGVGLGGILMLYLMQKMGQQ
WGKKNKVVWLLALGRSAVVLVLFTGISYAVNKGRDDDPVFALSKVKSDGIATPRMPDSTL
IGKVFPRAIAPFIAAALEHLAIAKAFGRKNDYVTDPAQELVYLGFTNFFNAFFSSMSVGG
AMSRTAVNSESGVKSPAYGIIAGSVVILSIFKLSPALYWIPKATLAAIIVTAVWHIVIPP
KVFYGYWRTSLVDFTTAMLAFWLTLFVSSEVGIGTAVGFNILYHLLFMAFHRVRRITCLS
ILPTTRLPAGSHAIPPDTQVLRIHQSMLFYNAYRIKNQCLEHIQTFHSGDAATLEAAHAS
RNWSMAGHTRARRLRAKAGVLDEPVQIRTVVLDFAGVWNIDTTGLVAMADLLADVEAFGG
RGVRVLFVGLGARVRERFSRGGWTVYDVDGDGGSSGGARIAEANPAAHAPSKRVVYVYKS
LEDAVFTSRLAGRNEGSAESLEVRVVGGSKEMV
Download sequence
Identical sequences E4ZRE0
XP_003837574.1.65998 CBX94134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]