SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX94830 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX94830
Domain Number 1 Region: 99-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-92
Family G proteins 0.000000253
Further Details:      
 
Domain Number 2 Region: 559-679
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.03e-32
Family Translational machinery components 0.0002
Further Details:      
 
Domain Number 3 Region: 482-560
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.37e-23
Family EF-G/eEF-2 domains III and V 0.00014
Further Details:      
 
Domain Number 4 Region: 683-774
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.59e-22
Family EF-G/eEF-2 domains III and V 0.00086
Further Details:      
 
Domain Number 5 Region: 351-378,408-479
Classification Level Classification E-value
Superfamily Translation proteins 6.83e-21
Family Elongation factors 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBX94830
Sequence length 780
Comment pep:novel supercontig:ASM23037v1:FP929125:824418:826974:-1 gene:LEMA_P118330.1 transcript:CBX94830 description:"Similar to elongation factor G 1 "
Sequence
MRVQSLFRAQSLATNGLRCSARSATRTGSRCALSTVAATRTAYTQGLKTDTWISNQTSNG
QRRWASVAAQVLEQAKADPSTLTQEKIVENLDPVEWERLSRVRNIGIAAHIDSGKTTATE
RVLFYTGRINNIHEVRGKDAVGAKMDSMDLEREKGITIQSAATFCDWTKKNEKGEEEKYH
INLIDTPGHIDFTIEVERALRVLDGAVMILCAVSGVQSQTITVDRQMRRYNIPRISFVNK
MDRMGANPWKAVEQINQKLRIPAAALQVPIGREDGFLGVVDLIRMKAIYNEGAKGEIIRE
TDEIPEDIVELCKEKRQKLIETLADVDDEIAELFLDEQEPGIAQIKAAIRRATIALKFTP
VMMGSALADKSVQPMLDAVCDYLPNPSEVENMALDKKRNEAPVKLVSYNSLPFVGLAFKL
EESSFGQLTYIRVYQGTLKKGMNVFNARSDKRVRIPKIVRMHSNDMEEVPEIGAGEICAT
SMFVPEPVISLSIKPKHTKDTPNFSKAMNRFTREDPTFRVHVDAESQETVISGMGELHLD
IYVERMRREYRVECETGQPQVAYRETMTQRVNFDHTLKKQSGGSGDYARVVGWMEPCESL
SENKFEQQISGGTISEKFLFACEKGFNASTAKGPLLGHKVLGTSMVINDGATHAVDSSEM
AFKMATQQAFRKAFIAGSPQVLEPLMKTTITAPNEFQGGVVGLLNKRNAVINDTEIGPED
FTVYADCSLNSMFGFSSQLRASTQGKGEFSMEFSHYSPAPPQLQRELVAKYEKEQAARNA
Download sequence
Identical sequences E4ZTH4
XP_003838309.1.65998 CBX94830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]