SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX95381 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX95381
Domain Number 1 Region: 579-607,643-694
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000491
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBX95381
Sequence length 838
Comment pep:novel supercontig:ASM23037v1:FP929127:652729:655291:-1 gene:LEMA_P025330.1 transcript:CBX95381 description:"Similar to sulfate permease "
Sequence
MASTTSKIGHGLAKILGIQLHYRNETGSERVTRGESVFTIDSADAYVEHEPTAREWLHEV
IPTGQELGEYAYSLFPFIHWIGRYNLQWFIGDLVAGLTVGAVVVPQSMAYAKLAQLPVEF
GLYSSFMGVLIYWFFATSKDITIGPVAVLSTVTGNVVLSAEAKLKDEGISRDIIASSLAI
VAGAIVLFLGLIRLGWIVDLISLPAISAFMTGSAISIAAGQVPAMMGITGFSTREPTYKV
IINIFKYLGRTDINASFGLTALFLLYAIRFSCNQLAKRFPTRAKLFFFLNTLRTAFVILL
YVLFSYLANRQHRANGTKPIITTLGSVPRGFKHARVPNITTDMVKAFSTDLPSVVIVLLI
EHISIAKSFGRVNNYTINPSQELVAIGVSNCLGPFLGAYPATGSFSRTAIKSKAGVRTPF
AGVITAVVVLLAIYALPAMFWYIPNAALSAVIIHAVGDLITPPNTVYQFWRISPLEVFIF
FAGVIVTVFTTIEIGIYVTVSVSAALFGFRAFKAKGRFMGRAKIHSVVGDHVLDPHDDDK
KRPSGRKTPAENEDSVREVFLPLDHQDGSNPSIQLLDPYPGIFIYRFSEGFNYPNANHYL
DQLTDTIFQKTRRTNPAGFARPGDRPWNDPGPRRGKETSDADGRPTLKAIILDMSSVNNV
DLTSIQNLIDVRNQLDKYAAPDTVDWHFCNINNRWTKRALAAAGFGYYTPDNENGITHRW
KPIFSVAEIGGSYSAAAEAEAEANRRAQRTLSRSRSHDIEATAQQQEQQQQQHSESEGNS
DAGSLSKQLQYSTAYGATDTQVKSGRVAVVQGLNRPLFHVDVTAALNSALANAQRKSH
Download sequence
Identical sequences E4ZXH1
CBX95381 XP_003838860.1.65998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]