SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX96234 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX96234
Domain Number 1 Region: 254-388
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000932
Family CBS-domain pair 0.0065
Further Details:      
 
Weak hits

Sequence:  CBX96234
Domain Number - Region: 51-145
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.00927
Family PyrH-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBX96234
Sequence length 751
Comment pep:novel supercontig:ASM23037v1:FP929128:561830:564252:1 gene:LEMA_P111530.1 transcript:CBX96234 description:"Similar to DUF21 and CBS domain protein (Mam3) "
Sequence
MAAVAAMSSSPRSSMRNGFSSHPAARIVILALFHACAPMVKALPLGGMMTALADHDVPKS
ADDASLWLYLGVAILLVLGGGVFAGLTIALMGQDEIYLQVLAHSGDVHERRNAKKVLKLL
QRGKHWVLVTLLLSNVITNETLPIVLDRSLGGGWPAVVSSTVLIVIFGEVVPQSICVRYG
LPIGAFMAPIVLALMYIMGIAAWPTAKLLDYLLGEDHGTVYKKSGLKTLVNLHQSLGLEH
ERLNEDEVTIITAVLDLKAKAVGNIMTPMKDVFTMSSDTVLDEKMMDNILSAGYSRIPIH
TPENKNNFVGMLLVKMLITYDPEDALHVRDFALATLPETRPETSCLDILNFFQEGKSHMV
LVSEFPAEARGAVGVVTLEDVIEELIGEEIIDESDVFIDVHKAIRRMAPAPRARVPRGRV
ITDPVRKLSDAALVTVEIGAEEQNGKTVNRKSSLPEVSDALLKPAIVLRRRSSGSKGTME
PLRSDDPEVMQHLRHLGPSNAANRPKSTRINTVKIKPGGQTPDIPNTIPENSQPAPGTAS
SPDSHAPQGGVGEGLLSSAGREASDGVHSVAVGYGTMAPNSDRMSWKSGRSGLREAEDEP
ISPKGDSQANNDDTHLNVDHHSSSQPSHSRERSRSVSTIASLRSAKSPPHSPLTKRHTAR
SGSISENVVDVNGIKKIVLETTSSSDSEDKQTGGRADGAEDMCHWQHSEAESSNVGGDKG
GGGKKKRKKRGKKKKGGKEDGAESQPLLGNR
Download sequence
Identical sequences E4ZXY9
XP_003839713.1.65998 CBX96234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]