SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX96795 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX96795
Domain Number 1 Region: 424-837
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 6.04e-89
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0005
Further Details:      
 
Domain Number 2 Region: 284-422
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.46e-36
Family Ferredoxin domains from multidomain proteins 0.00018
Further Details:      
 
Domain Number 3 Region: 211-283
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.41e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CBX96795
Sequence length 923
Comment pep:novel supercontig:ASM23037v1:FP929130:212196:215388:1 gene:LEMA_P099260.1 transcript:CBX96795 description:"Putative uncharacterized protein "
Sequence
MAPRGPRDAAVRSSVVFTCLIDVGSSWLQLAPAPAPSCAVKCSAMTMFKTWLTGRLTRPN
QSGELWMLLSYTTIFPHTIVTSARVTSIKKSAVYVATLVRNEISSANASSAPATSPGKAR
MRTRSDSSFLTNQGADYETVPGECQGGERQAFFEVTEGRELRRKHAHRSPPPRALTMLRQ
QLIRSLKRPAYRAALNGSRAFTASAPRPAEVELTIDGQKVSIEAGAALIQACEKAGVTIP
RYCYHEKLMIAGSCRMCLVEVERAPKPVASCAWPVQPGMVVKTNSPLVHKAREGVMEFLL
ANHPLDCPICDQGGECDLQDQSMRYGADRGRFHEIGGKRAVEDKNIGPLIKTSMNRCIHC
TRCVRFSNDIAGAPEMGSFGRGNDLEIGTYLETALDSELSGNVIDLCPVGALTSKPYAFK
ARPWELYKTETIDVLDALGSNIRVDSRGLQVMRVLPRLNDDINEEWINDKTRFACDALST
QRLVNPLIRVNDQFQPASWEQALVEIGNAYKKLAPKGNEFKVIAGHLVETETLVAMKDLA
NKLGSDNLGLDQPGGSEPIAHGIDIRSNYAFNSRIYGVEDADAILLVGTNPRHEAAVLNA
RIRKQWLRSDLEIGLVGEDFESTFEYQKLGGSATDLKSALSGEFGKKLASAKKPMIIVGS
AVTEHADAKSFYEQIGAFVEKNKANFLTEEWNGFNILQRAASRTGAYEVGFTVPSPEVAQ
TKPKFVWLLGADEINEAELPKDAFVVYQGHHGDRGAQLADVVLPGAAYTEKSVTYVNTEG
RVQMTRAAVGLPGASRDDWKIVRAASEYLGAELPYDDVEQLRDRMVEISPALRRYDLIED
TSVASLSKVQLVDQNKGTQATGAPLKKPIEDFYFTDVISRNSPTMARCSAAKAQKNPETN
FMAPGYPEPQVGYGPQKAIAANV
Download sequence
Identical sequences E4ZZT5
XP_003840274.1.65998 CBX96795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]