SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CBX97680 from Leptosphaeria maculans 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBX97680
Domain Number 1 Region: 737-960
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000959
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 2 Region: 551-764
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000327
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  CBX97680
Domain Number - Region: 278-524
Classification Level Classification E-value
Superfamily Tropomyosin 0.000111
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number - Region: 1041-1322
Classification Level Classification E-value
Superfamily Tropomyosin 0.000183
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CBX97680
Sequence length 1693
Comment pep:novel supercontig:ASM23037v1:FP929132:490331:495542:1 gene:LEMA_P090890.1 transcript:CBX97680 description:"Putative uncharacterized protein "
Sequence
MASPPNGSDQDRRPAACTRSRTGLENMLPTSFGKRDRSKSRTRPGPAPHMSRSISSAMTD
SFVLDHRGSYRPSLHDNDKHAASASDPRKTEEEEGLMPISNWAHLNFLKNQRNTLRNELK
VQALAGAEAKRSVSSLRRLAFRMAVNISVKERQIATSAKNLSQSRTGNDLQSKEAETRIE
SLKRALRVEEKRNVEVLEALEHSTPKPKSQHRLQRSLLSPPPSPPTQLSDYSESSLGSPR
TPTRPTTFDRSLTPGLESPTEIRTSDSRLIQAKRDCDRALAACRSRITELQEECAQSREI
NESILASRDELEHEIKDHQSRIATLERSRAAMEATLVATKQQLLSVKETEDRLTQDLNNK
AQEIRNLEHSDKDKQQTIDILREEKLALEKMLQIRASEFQELEHRTSSLDADTRLLQSKL
ESAERQEASLQDRFNEKERAREDLQKRLDRGTRYIQLLEHKVRHLESDAVENSKLKTQLQ
ESKEATDNAKAALATLASEVVTLRRNLETETNAHKQLSTEVETNRATISQLKDEHAIAQS
TLEQERALQSALRTELESTRSLYELACNNLQAAETRVQSLENLDHDNREKLEALRDGKTS
LEADLREARESLLILQQDKKDGEAELSRMEKSRAELRDRLQTLEGQVVSLQQELEDAHIA
ETAMKEAHAMDLQKNRTQLTEFETSLRVLKGMLASADQAKLDLQEEVHHIQSSKESTELQ
LIDALQSRESYRLRCDSIEDQLKSIESERTMLVTRVSQLENDLANSSVAKNALEERLDDA
SARRKELESLVSELQSSLEAAHDVSSTLEAAYSSAQRDSESSRAQVANLHEQLDEIKLSR
EEAEARYQASNNSNKLLEDQLLVAKSKLAEVESDSNSILTELSAVRNELSQYEKQNAVLT
TSLEALQMQSKDQQEELAVAKSRWEAAEQRAETLQLKLSMAEEEIDMTRREKLKTEGYLE
EAIESNKDLDNSLRTARQERANAEERLTAALGLSLQATSELASTQSKLFNADSERAHLVS
TLNEKEVELEALLQSRAKIQSQLNESVARVTTLEEDLLSTRTQLLDIESENSSHVAELSA
NEEMFARLRKQETDLKKQLAQAVAHSASLEEDAAHAHKRVLELEQRTAEYLAQLSSSSAD
TEILRAAYAQSENHLKTVTVDKDDLEKKLRATAMRLDIAEVEGLRSATELLEADHVLKIL
RESNAKLEQSEQHLSARLASAENDLHTVRETNSRLESILERVTKDMDQAEATVKESSRQF
EEYLTESQTKLAESHAKLDAARSAKLKLRDRLSEKAIEMEAVTAENRSLHKQVDEQTVEL
GDLKKGKAKLEEALSLKESYMNELRSSSDKRIRSLNAAYNGLKKEHEERAHQTRPTVARN
STSRLEAELRSKDAEIEKMQTSKDSYAALKREVESLREDKKAFQRLVEQLQEKVEQLQVL
EEWVDPIHIGSPNSSRHITILDDTFYSLPSSPSTGHTKSPRPESIFSMGHQGDRPPTRAS
QHSHDEDLDGWAQEVEHVRMLRNETAIQLRDLRRSKHDLKKDLKHTEAELHRLEKEHKDK
RYRNLLKKGHRPTTPFRSPALPSEPFDDHTSHVPPTTPIRPRTSSGIPITAKSDFRPGHK
SRHSTMDMPQDMFASSPDSEHRRWPTTLRNPHATSQRPGTGHSLRQRLSHRQTTSVKEEE
HGGKRRWSSGKGS
Download sequence
Identical sequences E5A1W3
CBX97680 XP_003841159.1.65998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]