SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161503053|ref|YP_001570165.1| from Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161503053|ref|YP_001570165.1|
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily YjgF-like 4.71e-26
Family YjgF/L-PSP 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161503053|ref|YP_001570165.1|
Sequence length 114
Comment hypothetical protein SARI_01117 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]
Sequence
MTIVRIDAEDRWSDVVIHNNTLWYTGVPENLDADAFGQTANTLAQIDAVLEKQGSSKSRI
LDATIFLSDKADFAAMNKAWDAWVVAGHAPVRCTVQAGLMNPKYKVEIKIVAAV
Download sequence
Identical sequences A0A0V2ECG0 A0A1M3XZ96 A0A1X2TNC5 A0A221ZLB0 A0A2K2S5Y6 A0A2K2SBE7 A0A2K2SK09 A0A2K2T3G4 A0A2K2TEQ6 A9MNK0
gi|161503053|ref|YP_001570165.1| 41514.SARI_01117 CP000880|CDS_1084554-1084210 WP_000158031.1.100979 WP_000158031.1.101363 WP_000158031.1.1204 WP_000158031.1.13465 WP_000158031.1.17694 WP_000158031.1.1832 WP_000158031.1.18796 WP_000158031.1.20438 WP_000158031.1.2155 WP_000158031.1.22026 WP_000158031.1.26414 WP_000158031.1.27123 WP_000158031.1.2915 WP_000158031.1.2974 WP_000158031.1.3208 WP_000158031.1.4114 WP_000158031.1.45947 WP_000158031.1.49041 WP_000158031.1.52052 WP_000158031.1.5907 WP_000158031.1.59204 WP_000158031.1.64036 WP_000158031.1.64715 WP_000158031.1.65308 WP_000158031.1.6558 WP_000158031.1.70262 WP_000158031.1.70692 WP_000158031.1.73242 WP_000158031.1.74673 WP_000158031.1.75150 WP_000158031.1.79300 WP_000158031.1.80363 WP_000158031.1.81612 WP_000158031.1.90302 WP_000158031.1.90617 WP_000158031.1.90752 WP_000158031.1.9276 WP_000158031.1.98266 WP_000158031.1.98558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]