SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161505060|ref|YP_001572172.1| from Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161505060|ref|YP_001572172.1|
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily YjgF-like 1.27e-43
Family YjgF/L-PSP 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|161505060|ref|YP_001572172.1|
Sequence length 128
Comment hypothetical protein SARI_03193 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]
Sequence
MSKTIATENAPAAIGPYVQGVDLGSMVITSGQIPVDPKTGSVPEDVSAQARQSLENVKAI
VEAAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNATFPARSCVEVARLPKDVKIE
IEAIAVRR
Download sequence
Identical sequences A0A1X2TI09 A9MEW4
gi|161505060|ref|YP_001572172.1| 41514.SARI_03193 WP_000047545.1.17694 WP_000047545.1.2915 WP_000047545.1.3208 WP_000047545.1.4114 WP_000047545.1.5907 WP_000047545.1.59204 WP_000047545.1.64036 WP_000047545.1.6558 WP_000047545.1.79300 WP_000047545.1.90617 CP000880|CDS_3105332-3105718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]