SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407457779|ref|YP_006736084.1| from Chlamydia psittaci WS/RT/E30

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407457779|ref|YP_006736084.1|
Domain Number 1 Region: 11-307
Classification Level Classification E-value
Superfamily SIS domain 3.78e-51
Family mono-SIS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407457779|ref|YP_006736084.1|
Sequence length 329
Comment sugar isomerase, KpsF/GutQ family protein [Chlamydia psittaci WS/RT/E30]
Sequence
MRSPTTSIDLCQDIVSKQRESLERFFDTFQCEDTWVLAEKILNHQGSIFFSGVGKSGCIA
RKIVATLQSFGERALFLASGDLLHGDLGVVRPGDIVCLFSKSGETRELLECIPYLKERGV
FIAGITSATYSSLAVLCDHVVILPMIEELDPFNLVPTTSTTCQLLFGDLLAITLLRSRQI
SLADYGKNHPGGQIGLKVIGKIRDYMFPKTEVPFCSPEDTIADSLDIFSSYGCGCVCIVN
EKFEILGIFTDGDLRRSLTRHGGDILSQRLKDVMTPNPRVISEDADVLLGLQMMETGSPV
TILPVVDAKDQKYVVGLLQMHTLAKAGLI
Download sequence
Identical sequences S4LZ78 S7IJQ5 S7IW60
WP_014943702.1.34025 WP_014943702.1.66441 WP_014943702.1.8387 WP_014943702.1.9241 gi|407457779|ref|YP_006736084.1| gi|407455046|ref|YP_006733937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]